--- Log opened Tue Apr 11 00:00:23 2017 00:28 < nmz787_> https://www.youtube.com/watch?v=KLqyKeMQfmY 00:28 < nmz787_> .title 00:28 < yoleaux> How Helen Keller Learned to Talk. - YouTube 00:29 < nmz787_> """Helen Keller and Her teacher Anne Macy Sullivan explain how Helen learned to speak. Year:1928. TRANSCRIPT: Anne Sullivan speaking: "When I first saw Helen Keller, She was six years and eight months old.She had been blind and deaf and mute since her eighteenth month as a result of an illness.She had no way of communicating with those around her except for a few imitative signs that she had made fo 00:29 < nmz787_> r herself. A push meant go and a pull ... 00:29 < nmz787_> ... meant come and so on. She had observed that we did not use the hands when we were talking to each other. And I let her see by putting her hand on my face how we talked with our mouths. She felt the vibrations of the spoken word. Instantly she spelled "I want to talk with my mouth" That seemed impossible. But after experimenting for a time we found that by placing her hand in this position, the t 00:29 < nmz787_> humb resting on the throat. Right at the ... 00:29 < nmz787_> ... larynx. The first finger on the lips. The second on the nose, we found that she could feel the vibration of spoken words.For instance on the throat she feels the "G" the hard "G". And the "K" sound. On the lips she feels the "B" and the "P" .With the second finger on the nose the nasal sound. The "N" .The first word she learned to articulate was the little word "it". With the hand in this positi 00:29 < nmz787_> on I made the vowel "I". She felt it. ... 00:29 < nmz787_> ... Then I made the "T". She feels it with the fingers on my lips. Then I put the two letters together to form the word "it". And the first word was learned. After seven lessons she was able to speak the sentence word by word (Helen Keller speaking)..."I am not dumb now".""" 00:30 < nmz787_> that could be the next google glass upgrade... artificial hand jammed in your face 00:50 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has joined ##hplusroadmap 00:54 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has quit [Ping timeout: 255 seconds] 01:09 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has joined ##hplusroadmap 01:14 -!- Malvolio [~Malvolio@unaffiliated/malvolio] has quit [Ping timeout: 240 seconds] 01:44 -!- augur [~augur@84.207.252.45] has joined ##hplusroadmap 01:44 -!- augur [~augur@84.207.252.45] has quit [Read error: Connection reset by peer] 01:46 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has quit [Ping timeout: 240 seconds] 01:49 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has joined ##hplusroadmap 02:54 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has quit [Ping timeout: 255 seconds] 02:55 -!- sachy [~sachy@nat.brmlab.cz] has joined ##hplusroadmap 02:59 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has joined ##hplusroadmap 03:07 -!- bluebear_ [~dluhos@80.95.97.194] has joined ##hplusroadmap 03:11 -!- pompolic [~A@unaffiliated/pompolic] has quit [Ping timeout: 240 seconds] 03:13 -!- pompolic [~A@unaffiliated/pompolic] has joined ##hplusroadmap 03:19 -!- augur [~augur@94.117.128.162] has joined ##hplusroadmap 03:19 -!- augur [~augur@94.117.128.162] has quit [Remote host closed the connection] 04:06 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has quit [Ping timeout: 252 seconds] 04:29 -!- augur [~augur@94.119.64.9] has joined ##hplusroadmap 04:29 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has joined ##hplusroadmap 04:39 -!- Gurkenglas [~Gurkengla@dslb-178-005-161-154.178.005.pools.vodafone-ip.de] has joined ##hplusroadmap 04:45 -!- Guest7713 is now known as abetusk 04:48 -!- esmerelda [~mabel@unaffiliated/jacco] has quit [Ping timeout: 252 seconds] 05:10 -!- darsie [~darsie@84-113-55-42.cable.dynamic.surfer.at] has joined ##hplusroadmap 05:12 -!- augur [~augur@94.119.64.9] has quit [Remote host closed the connection] 05:13 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has quit [Ping timeout: 268 seconds] 05:16 -!- fleshtheworld [~fleshthew@2602:306:cf0f:4c20:1028:4e0b:a566:a9c1] has joined ##hplusroadmap 05:16 -!- chris_99 [~chris_99@unaffiliated/chris-99/x-3062929] has joined ##hplusroadmap 05:17 -!- augur [~augur@94.119.64.27] has joined ##hplusroadmap 05:21 -!- augur [~augur@94.119.64.27] has quit [Ping timeout: 240 seconds] 05:26 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has joined ##hplusroadmap 05:26 -!- augur [~augur@94.119.64.24] has joined ##hplusroadmap 05:28 -!- chris_99 [~chris_99@unaffiliated/chris-99/x-3062929] has quit [Ping timeout: 240 seconds] 05:28 -!- Gurkenglas [~Gurkengla@dslb-178-005-161-154.178.005.pools.vodafone-ip.de] has quit [Ping timeout: 252 seconds] 05:31 -!- augur [~augur@94.119.64.24] has quit [Ping timeout: 245 seconds] 05:31 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has quit [Ping timeout: 260 seconds] 05:31 -!- Gurkenglas [~Gurkengla@dslb-178-005-161-154.178.005.pools.vodafone-ip.de] has joined ##hplusroadmap 05:32 -!- chris_99 [~chris_99@unaffiliated/chris-99/x-3062929] has joined ##hplusroadmap 05:36 -!- augur [~augur@94.119.64.23] has joined ##hplusroadmap 05:43 -!- jtimon [~quassel@70.30.134.37.dynamic.jazztel.es] has joined ##hplusroadmap 05:45 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has joined ##hplusroadmap 05:47 < kanzure> don't everyone speak at once. 05:51 -!- augur [~augur@94.119.64.23] has quit [Ping timeout: 255 seconds] 05:55 -!- augur [~augur@94.119.64.28] has joined ##hplusroadmap 06:00 < kanzure> what are some good links for explaining the evils of MPEG-LA? 06:17 -!- Gurkenglas [~Gurkengla@dslb-178-005-161-154.178.005.pools.vodafone-ip.de] has quit [Ping timeout: 245 seconds] 06:18 -!- fleshtheworld [~fleshthew@2602:306:cf0f:4c20:1028:4e0b:a566:a9c1] has quit [Quit: Leaving] 06:44 < kanzure> https://www.forbes.com/sites/bretswanson/2013/04/30/mpeg-la-shows-need-to-rebuild-ip-foundations/#51b1fd043797 06:44 < kanzure> http://endsoftpatents.org/2011/02/mpeg-las-attack-on-vp8-video-highlights-need-for-software-patent-abolition/ 06:44 < kanzure> http://techrights.org/2015/07/28/mpeg-la-dash/ 06:44 < kanzure> https://www.engadget.com/2010/05/04/know-your-rights-h-264-patent-licensing-and-you/ 07:58 -!- souljack_ is now known as souljack 08:06 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has quit [Remote host closed the connection] 08:06 -!- Malvolio [~Malvolio@unaffiliated/malvolio] has joined ##hplusroadmap 08:12 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has joined ##hplusroadmap 08:35 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has quit [Quit: Leaving.] 08:54 < kanzure> .tw https://twitter.com/BoredSynBio/status/703639039488991232 08:54 < yoleaux> When it nanorains it nanopores. (@BoredSynBio) 09:00 < cluckj> that is a pretty great joke 09:05 -!- nmz787_i [~ntmccork@134.134.139.76] has joined ##hplusroadmap 09:08 -!- nmz787_i1 [~ntmccork@134.134.139.82] has joined ##hplusroadmap 09:09 -!- nmz787_i [~ntmccork@134.134.139.76] has quit [Ping timeout: 240 seconds] 09:12 < nmz787_i1> how're all you diploids today? 09:13 -!- Gurkenglas [~Gurkengla@dslb-178-005-161-154.178.005.pools.vodafone-ip.de] has joined ##hplusroadmap 09:15 < kanzure> checking my ploidy 09:41 < nmz787_i1> .tw https://twitter.com/BoredSynBio/status/822118844802203650 09:41 < yoleaux> (Yo Momma battle) Yo momma so dumb, the only culture she has is her microbiome. *drops mic* (@BoredSynBio) 09:46 -!- bluebear_ [~dluhos@80.95.97.194] has quit [Ping timeout: 240 seconds] 10:13 -!- augur [~augur@94.119.64.28] has quit [Remote host closed the connection] 10:17 -!- jtimon [~quassel@70.30.134.37.dynamic.jazztel.es] has quit [Ping timeout: 240 seconds] 10:18 -!- augur [~augur@94.119.64.17] has joined ##hplusroadmap 10:22 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has joined ##hplusroadmap 10:26 -!- sbodin [~sbodin@176.113.121.17] has joined ##hplusroadmap 10:28 -!- augur [~augur@94.119.64.17] has quit [Ping timeout: 252 seconds] 10:54 -!- bsm1175321 [~mcelrath@157.130.6.242] has joined ##hplusroadmap 11:40 -!- bluebear_ [~dluhos@80.95.97.194] has joined ##hplusroadmap 11:51 -!- bluebear_ [~dluhos@80.95.97.194] has quit [Quit: Leaving.] 12:08 -!- jtimon [~quassel@70.30.134.37.dynamic.jazztel.es] has joined ##hplusroadmap 12:14 -!- opiate [~spoar@31.24.231.199] has joined ##hplusroadmap 13:05 -!- m4l3z [~m4l3z@2a01cb040226f200b5364249e24c5c30.ipv6.abo.wanadoo.fr] has joined ##hplusroadmap 13:12 < kanzure> bloop 13:31 < kanzure> https://www.novoprolabs.com/p/foxo4-dri-peptide-318716.html 13:32 < kanzure> H-LTLRKEPASEIAQSILEAYSQNGWANRRSGGKRPPPRRRQRRKKRG-OH 13:32 < kanzure> yay eightpennies is still alive 13:33 < kanzure> "I currently stack and cycle plant derived inhibitors of bcl-2 and other bcl antiaptotic factors in an effort to get partial clearance of my senescent cell load. ... acute interest in dasatinib, navitoclax and the FOXO4 - p53 route." 13:35 < kanzure> "Targeted apoptosis of senescent cells restores tissue homeostasis" http://diyhpl.us/~bryan/papers2/longevity/Targeted%20apoptosis%20of%20senescent%20cells%20restores%20tissue%20homeostasis%20-%202017.pdf 13:36 < kanzure> http://diyhpl.us/~bryan/papers2/longevity/2017-04-11-senolytics.txt 14:03 -!- nmz787_i [ntmccork@nat/intel/x-vzlzxawcformumhk] has joined ##hplusroadmap 14:04 -!- JenElizabeth [~Jen@cpc76808-brmb10-2-0-cust571.1-3.cable.virginm.net] has joined ##hplusroadmap 14:05 -!- nmz787_i1 [~ntmccork@134.134.139.82] has quit [Remote host closed the connection] 14:23 -!- opiate [~spoar@31.24.231.199] has quit [Quit: Leaving] 14:23 -!- m4l3z [~m4l3z@2a01cb040226f200b5364249e24c5c30.ipv6.abo.wanadoo.fr] has quit [Ping timeout: 252 seconds] 14:26 -!- m4l3z [~m4l3z@2a01cb040226f200b5364249e24c5c30.ipv6.abo.wanadoo.fr] has joined ##hplusroadmap 14:27 -!- opiate [~spoar@104.238.169.42] has joined ##hplusroadmap 14:30 -!- opiate [~spoar@104.238.169.42] has quit [Client Quit] 14:45 -!- bsm1175321 [~mcelrath@157.130.6.242] has quit [Ping timeout: 260 seconds] 14:56 < archels> fenn: yo 15:01 -!- m4l3z [~m4l3z@2a01cb040226f200b5364249e24c5c30.ipv6.abo.wanadoo.fr] has quit [Quit: Leaving] 15:13 -!- chris_99 [~chris_99@unaffiliated/chris-99/x-3062929] has quit [Quit: Leaving] 15:29 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has quit [Ping timeout: 240 seconds] 15:29 -!- nmz787_i [ntmccork@nat/intel/x-vzlzxawcformumhk] has quit [Quit: Leaving.] 15:33 -!- nmz787_i [ntmccork@nat/intel/x-jfwfxqhmkykvzmqo] has joined ##hplusroadmap 15:38 -!- opiate [~spoar@31.24.226.241] has joined ##hplusroadmap 15:40 -!- nmz787_i [ntmccork@nat/intel/x-jfwfxqhmkykvzmqo] has quit [Quit: Leaving.] 15:53 < kanzure> "sequencing-by-ligation" 15:54 < kanzure> .wik long cai 15:54 < yoleaux> kanzure: Sorry, that command (.wik) crashed. 15:56 < cluckj> .title https://www.nytimes.com/2017/04/11/opinion/gut-hack.html?smid=tw-nytopinion&smtyp=cur 15:56 < yoleaux> cluckj: Sorry, that doesn't appear to be an HTML page. 15:56 < kanzure> .wik chimeric antigen receptor 15:56 < yoleaux> "Chimeric antigen receptors (CARs), (also known as Chimeric immunoreceptors, Chimeric T cell receptors, Artificial T cell receptors) are engineered receptors, which graft an arbitrary specificity onto an immune effector cell (T cell)." -- https://en.wikipedia.org/wiki/Chimeric_antigen_receptor 15:56 < kanzure> what's with all the CAR T cell therapy stuff 15:58 < kanzure> quake lab is doing a startup 'agenovir' for using cas9 as human antiviral treatment 16:01 < kanzure> "Recording action potential propagation in single axons using multi-electrode arrays" http://biorxiv.org/content/early/2017/04/11/126425 https://twitter.com/biorxiv_neursci/status/851887783811715072 16:01 < kanzure> i thought we had already done that with patch clamp setups 16:03 < kanzure> "High accuracy base calls in nanopore sequencing" using unsupervised machine learning http://biorxiv.org/content/early/2017/04/11/126680 https://twitter.com/biorxivpreprint/status/851887637128511489 16:17 < kanzure> something about attaching photoswitches to arbitrary receptors on neurons, 'synthetic optogenetics' http://embor.embopress.org/content/early/2017/04/10/embr.201744010 16:22 -!- darsie [~darsie@84-113-55-42.cable.dynamic.surfer.at] has quit [Ping timeout: 255 seconds] 16:57 -!- nmz787_i [ntmccork@nat/intel/x-ljcqujtscwbwzvju] has joined ##hplusroadmap 17:01 < kanzure> nmz787_i: there were some old emails about using straws for electrophoresis 17:02 < fenn> archels: yes? 17:05 -!- Gurkenglas [~Gurkengla@dslb-178-005-161-154.178.005.pools.vodafone-ip.de] has quit [Ping timeout: 240 seconds] 17:21 -!- TC [~talinck@cpe-174-97-113-184.cinci.res.rr.com] has joined ##hplusroadmap 17:21 -!- TC is now known as Guest77006 17:24 -!- hehelleshin [~talinck@cpe-174-97-113-184.cinci.res.rr.com] has quit [Ping timeout: 240 seconds] 17:28 < Jenda`> kanzure: The efficiency of photosynthesis is AFAIK 1 to 2 %. The solar irradiance is about 1.3 kW/m^2. Human needs 9 MJ/day, which means 100 W power. So it is about 10 m^2 in the space and ~30m^2 on the Earth (because of the day/night cycle) 17:29 < cevi_> solution: live a lot closer to the sun? 17:30 < kanzure> or just eat animals for their energy 17:33 -!- Regex [~Cara@2601:1c0:8500:5edb:e9be:c6c4:6e2b:93fc] has joined ##hplusroadmap 17:37 < adlai> cf "your dogs need meat and your children need vaccines" and associated permutations 17:38 < nmz787_i> kanzure: yeah I remember that, keiki gels 17:39 < nmz787_i> solution for photosynthesis is engineer it to be better 17:39 < nmz787_i> /me waves hands 17:39 < cevi_> even if efficiency is 100% it doesn't seem good enough? 17:40 < cevi_> maybe it would be easier to engineer humans to use less energy 17:41 < adlai> why can't we have both?.gif 17:41 < nmz787_i> what adlai said 17:41 < nmz787_i> calorie restriction is good for longevity anyway 17:42 < adlai> wouldn't it be longevity-better to both consume and burn more calories? given the whole "exercise reduces the chance of pump implosion" assumption 17:43 < nmz787_i> pump? 17:43 < nmz787_i> heart attack? 17:44 < nmz787_i> calorie restriction in mice is significant for life extension (in mice) 17:49 < adlai> there was a paper here a while back that tl;dr'd in my mind (due more to paywall than lack of time) as "exercise increases longevity (in humans)" 18:01 -!- opiate [~spoar@31.24.226.241] has quit [Ping timeout: 245 seconds] 18:17 < nmz787_i> adlai: I hope you know about jamming sci-hub.io just before the first / in any URL (not counting the // in http://) 18:27 < adlai> now i do! thanks to you 18:48 < fenn> humans are already optimized for low energy usage, there are other low hanging fruit to try first 18:48 -!- nmz787_i [ntmccork@nat/intel/x-ljcqujtscwbwzvju] has quit [Quit: Leaving.] 18:50 < fenn> you'd need some kind of carbonic acid storage organism to do photosynthesis in a vaccum 18:50 < fenn> organ* 18:51 < fenn> i'd rather have all that functionality be part of a space suit 18:52 -!- nmz787_i [~ntmccork@134.134.139.72] has joined ##hplusroadmap 18:57 -!- yashgaroth [~yashgarot@2606:6000:cd4d:3300:f5e0:f867:a11d:8d52] has joined ##hplusroadmap 18:58 < kanzure> to be clear, george church's "fly into space without a space suit" proposal was something he did /not/ want to pursue 18:59 < cevi_> not immediately, or not ever? 19:02 < kanzure> heh 20:23 < docl> So apparently refining 1 ton of potassium chloride into its constituent isotopes by passing it through a mass spectrometer costs about 4.5 billion dollars worth of energy? 20:23 < docl> .title https://www.youtube.com/watch?v=UiDsZ4TZAGs 20:23 < yoleaux> It costs 70 MILLION dollars per kg! But why? - YouTube 20:24 < docl> .title https://en.wikipedia.org/wiki/Isotopes_of_potassium 20:24 < yoleaux> Isotopes of potassium - Wikipedia 20:25 < fenn> are there no gaseous compounds of potassium? 20:26 < docl> K41 is 6.7% abundant, so we are talking 67 kg per ton. If that costs 70 million dollars worth of energy per kg, it's 4.5 billion dollars... which seems hard to believe 20:26 < fenn> i doubt anyone has refined that much potassium 20:26 -!- Malvolio [~Malvolio@unaffiliated/malvolio] has quit [Quit: brb] 20:27 < fenn> also those mass spectrometers are precision measuring instruments 20:27 * fenn watches the video 20:28 < fenn> jfc nevermind 20:29 < fenn> i know what a kilogram is 20:29 -!- Malvolio [~Malvolio@unaffiliated/malvolio] has joined ##hplusroadmap 20:29 < yashgaroth> wait until he weighs his phone 20:30 < fenn> potassium chloride might be gaseous so you could use all the fancy uranium enrichment processes 20:31 < docl> 5:30 is where he starts talking about the process. just a very general description of atomic separation by a mass spec type method 20:32 < fenn> "Enrichment of Potassium Isotopes with Macrocyclic Polyether Potassium Complexes" 20:32 < docl> and 10:10 he says "it's one of those things where the value of it is basically the energy costs of making it" 20:33 < fenn> well so is aluminum 20:36 < docl> I just have a hard time picturing that much energy being lost, even in a process like that. how hot are they getting those ions, and for how long? 20:37 < fenn> i'm sure there's some conversion between electron-volts and degrees kelvin but it seems kinda like a bad metaphor 20:37 < fenn> just ionization uses a lot of energy though 20:37 < fenn> per mole 20:38 -!- sbodin [~sbodin@176.113.121.17] has quit [Ping timeout: 240 seconds] 20:38 < fenn> oh it's lower than i expected 20:38 < fenn> 418 kJ/mol potassium 20:38 < yashgaroth> I imagine most of the energy goes into the big electromagnet 20:40 -!- Regex [~Cara@2601:1c0:8500:5edb:e9be:c6c4:6e2b:93fc] has quit [Quit: Leaving] 20:42 < justanotheruser> b 20:42 < docl> I wonder how many tesla are needed? Somewhere in the range of MRI magnets? 20:44 < docl> Probably depends on the desired throughput 20:58 < docl> Nah, that's overkill. You could probably just shoot a pulsed particle beam (using laser ablation or whatever) through a vacuum past a dead copper coil. It would then transfer momentum via magnetic friction (induction + joule heating) and be deflected, just like a projectile would. 21:02 -!- c0rw1n_ [~c0rw1n@132.90-242-81.adsl-dyn.isp.belgacom.be] has joined ##hplusroadmap 21:03 -!- c0rw1n [~c0rw1n@91.181.223.146] has quit [Ping timeout: 240 seconds] 21:34 -!- JenElizabeth [~Jen@cpc76808-brmb10-2-0-cust571.1-3.cable.virginm.net] has quit [Ping timeout: 240 seconds] 22:33 -!- yashgaroth [~yashgarot@2606:6000:cd4d:3300:f5e0:f867:a11d:8d52] has quit [Quit: Leaving] 22:39 -!- charlie [~spoar@31.24.226.221] has joined ##hplusroadmap 22:43 -!- pompolic [~A@unaffiliated/pompolic] has quit [Read error: Connection reset by peer] 22:43 -!- pompolic [~A@unaffiliated/pompolic] has joined ##hplusroadmap 22:54 < fenn> roujin-Z was pretty good 22:55 < fenn> a satire of the rising costs of healthcare for the elderly 22:58 < fenn> http://www.plasticpals.com/http://www.plasticpals.com/wp-content/uploads//2009/09/PanasonicRoboticBed.jpg 22:58 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has joined ##hplusroadmap 23:00 < fenn> the cat was the evil mastermind all along 23:01 -!- darsie [~darsie@84-113-55-42.cable.dynamic.surfer.at] has joined ##hplusroadmap 23:08 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has quit [Ping timeout: 252 seconds] 23:10 -!- charlie [~spoar@31.24.226.221] has quit [Ping timeout: 240 seconds] 23:15 -!- jtimon [~quassel@70.30.134.37.dynamic.jazztel.es] has quit [Ping timeout: 240 seconds] 23:22 -!- poppingtonic [~brian@unaffiliated/poppingtonic] has joined ##hplusroadmap 23:53 -!- docl_ [~docl@159.203.115.16] has joined ##hplusroadmap 23:55 -!- archels_ [charl@toad.stack.nl] has joined ##hplusroadmap 23:55 -!- archels [charl@toad.stack.nl] has quit [Read error: Connection reset by peer] 23:55 -!- pompolic [~A@unaffiliated/pompolic] has quit [Ping timeout: 260 seconds] 23:55 -!- catern [~catern@catern.com] has quit [Ping timeout: 260 seconds] 23:55 -!- pompolic [~A@unaffiliated/pompolic] has joined ##hplusroadmap 23:55 -!- docl [~docl@159.203.115.16] has quit [Ping timeout: 268 seconds] 23:56 -!- catern [~catern@catern.com] has joined ##hplusroadmap --- Log closed Wed Apr 12 00:00:24 2017