| --- Day changed Wed Apr 29 2009 | ||
| kanzure | cis-action: hey | 00:17 |
|---|---|---|
| kanzure | sorry, I had a meeting with someone | 00:17 |
| kanzure- | I}ruid: hey. | 00:23 |
| kanzure-_ | so, the first protein worth expressing would be GFP, which could be done with a kit | 00:41 |
| kanzure-_ | but beyond that I'm not quite sure | 00:41 |
| kanzure-_ | hey Splicer_. talking about agrobacterium. | 00:41 |
| kanzure-_ | http://pubs.caes.uga.edu/caespubs/pubcd/images/B1286-17.jpg | 02:02 |
| kanzure-_ | crown gall | 02:02 |
| kanzure-_ | http://www.ag.ndsu.edu/pubs/plantsci/crops/a1219-3.jpg | 02:03 |
| kanzure-_ | http://forestpests.org/rootbutt.html | 02:08 |
| cis-action | finally back | 02:19 |
| kanzure-_ | hi | 02:20 |
| cis-action | uh oh gotta leave again | 02:29 |
| kanzure-_ | hahah | 02:51 |
| kanzure-_ | "the mammary gland: bioreactor for the production of recombinant proteins" | 02:51 |
| kanzure-_ | YES | 02:51 |
| kanzure-_ | Using a 3.6-kb promoter of mouse uroplakin II gene, we have generated transgenic mice that express human growth hormone (hGH) in their bladder epithelium, resulting in its secretion into the urine at 100−500 ng/ml. | 02:52 |
| kanzure-_ | is there a plant that has a ridiculously convenient way to express proteins in plants? for harvesting purposes. other than latex (which you will have to centrifuge for) | 02:57 |
| kanzure-_ | http://en.wikipedia.org/wiki/Lemna | 03:22 |
| kanzure-_ | search for "secrete" | 03:22 |
| kanzure-_ | Lemna has been transformed by molecular biologists to express proteins of pharmaceutical interest. Expression constructs were engineered to cause Lemna to secrete the transformed proteins into the growth medium at high yield. Since the Lemna is grown on a simple medium, this substantially reduces the burden of protein purification in preparing such proteins for medical use, promising substantial reductions in manufacturing costs.[3][4] | 03:23 |
| kanzure-_ | genehacker: transgenic protein expression in mammary glands | 03:47 |
| kanzure-_ | fenn: are you going to show up tomorrow? | 03:58 |
| genehacker | hahahahhahahahaha | 04:01 |
| genehacker | is that the llama one? | 04:01 |
| kanzure-_ | no | 04:01 |
| genehacker | link? | 04:01 |
| kanzure-_ | one moment | 04:02 |
| genehacker | llamas actual produce microantibodies which are great for a lot of things | 04:04 |
| kanzure-_ | http://heybryan.org/books/papers/The%20mammary%20gland%20-%20bioreactor%20for%20the%20production%20of%20recombinant%20proteins.pdf | 04:04 |
| kanzure-_ | but actually I've been thinking of using dandelions for protein expression | 04:04 |
| kanzure-_ | because of the specific composition of the latex/plastic from the plant | 04:04 |
| kanzure-_ | and transfectability by agrobacterium | 04:05 |
| kanzure-_ | the bladder as a bioreactor: http://heybryan.org/books/papers/The%20bladder%20as%20a%20bioreactor%20-%20urothelium%20production%20and%20secretion%20of%20growth%20hormone%20into%20urine.pdf | 04:05 |
| genehacker | dandelions? | 04:06 |
| genehacker | what do we want to produce first off? | 04:07 |
| genehacker | illegal neuroenhancers perhaps? | 04:07 |
| genehacker | http://craphound.com/overclocked/Cory_Doctorow_-_Overclocked_-_Printcrime.html | 04:08 |
| kanzure-_ | what illegal neuroenhancers? | 04:08 |
| genehacker | there are none as of yet... | 04:09 |
| kanzure-_ | so ... | 04:09 |
| genehacker | what? | 04:10 |
| genehacker | why dandelions? | 04:10 |
| kanzure-_ | because it's easy. | 04:10 |
| kanzure-_ | you can eat them. | 04:10 |
| kanzure-_ | you can extract the latex | 04:10 |
| genehacker | latex for what? | 04:11 |
| kanzure-_ | do you not know where plastic comes from? | 04:12 |
| genehacker | yes I do | 04:13 |
| genehacker | it comes from | 04:13 |
| genehacker | oil | 04:13 |
| genehacker | are you talking about making stuff like PE? | 04:13 |
| genehacker | in dandelions? | 04:13 |
| kanzure-_ | "Latex refers generically to a stable dispersion (emulsion) of polymer microparticles in an aqueous medium. Latexes may be natural or synthetic. Latex as found in nature is the milky sap of many plants that coagulates on exposure to air" | 04:13 |
| kanzure-_ | PE? | 04:13 |
| kanzure-_ | I don't care about polyester really- although that would be neat | 04:14 |
| kanzure-_ | more interested in other proteins more than anything | 04:14 |
| kanzure-_ | the thing is that it's easy to extract it from dandelion | 04:14 |
| genehacker | polyethylene | 04:14 |
| kanzure-_ | because you don't have to do SDS-PAGE bullshit | 04:14 |
| genehacker | SDS PAGE? | 04:14 |
| genehacker | ok | 04:14 |
| kanzure-_ | SDS PAGE is usually how you do protein purification | 04:14 |
| kanzure-_ | but it's some complicated gel steps or something | 04:14 |
| genehacker | so let's make some DNA polymerases | 04:14 |
| kanzure-_ | why? | 04:15 |
| kanzure-_ | oh | 04:15 |
| genehacker | the type of things needed for PCR | 04:15 |
| kanzure-_ | yeah that's a good idea | 04:15 |
| genehacker | heh dandelions though | 04:15 |
| kanzure-_ | transgenic production of Tac polymerase. ok. | 04:15 |
| kanzure-_ | yeha | 04:15 |
| kanzure-_ | *yeah | 04:15 |
| kanzure-_ | they grow basically everywhere | 04:15 |
| genehacker | I was thinking any polymeras | 04:15 |
| kanzure-_ | so get a pot with some soil and a lamp | 04:15 |
| kanzure-_ | do you know the transformation protocol for agrobacterium? | 04:16 |
| kanzure-_ | I recently found this neat freeze-thaw protocol | 04:16 |
| kanzure-_ | with a add-the-new-DNA step in between or something | 04:16 |
| genehacker | perhaps we should modify them so they don't express those tufts of fiber on the seeds... | 04:16 |
| genehacker | hmmm... | 04:16 |
| genehacker | try DNA hack | 04:17 |
| genehacker | I saw something on their about argobacter transformation | 04:18 |
| genehacker | http://web.archive.org/web/20070309143649rn_1/www.accessexcellence.org/RC/AB/BA/Transforming_Plants.html | 04:20 |
| kanzure-_ | http://heybryan.org/books/papers/Increasing%20plant%20susceptibility%20to%20Agrobacterium%20infection%20by%20overexpression%20of%20the%20Arabidopsis%20nuclear%20protein%20VIP1.pdf | 04:22 |
| kanzure-_ | Increasing Increasing plant susceptibility to Agrobacterium infection by overexpression of the Arabidopsis nuclear protein VIP1 | 04:22 |
| kanzure-_ | Increasing Light strongly promotes gene transfer from Agrobacterium tumefaciensto plant cells | 04:23 |
| kanzure-_ | http://heybryan.org/books/papers/New%20biotechnological%20applications%20of%20coconuts.pdf | 04:23 |
| kanzure-_ | http://heybryan.org/books/papers/Light%20strongly%20promotes%20gene%20transfer%20from%20Agrobacterium%20tumefaciensto%20plant%20cells.pdf | 04:24 |
| genehacker | coconuts? | 04:27 |
| genehacker | heh | 04:27 |
| kanzure-_ | yep. | 04:27 |
| kanzure-_ | just add plasmid vector to coconut milk. | 04:27 |
| genehacker | so what other proteins do we need | 04:28 |
| genehacker | I'd say let's see if we can synthesize taq first then work on other stuff | 04:28 |
| kanzure-_ | the proteins required to do natural competence | 04:28 |
| kanzure-_ | MagA, for MRI reporter genes | 04:29 |
| kanzure-_ | mechanoreceptors, for magnetic guiding of cells | 04:29 |
| kanzure-_ | chlorohopdins-2 for laser-activation of neurons | 04:29 |
| genehacker | but first let's make a DNA synth | 04:29 |
| kanzure-_ | hrm. | 04:29 |
| kanzure-_ | do you have the sequence to taq? | 04:29 |
| genehacker | so we don't have to buy the DNA sequence | 04:29 |
| genehacker | no | 04:29 |
| genehacker | but ncbi.org does | 04:29 |
| genehacker | nah | 04:30 |
| genehacker | wait | 04:30 |
| kanzure-_ | then also insulin, dopamine, various other neurotransmitters | 04:30 |
| kanzure-_ | key opium proteins for a few bucks in the pocket | 04:30 |
| genehacker | hahahaha | 04:31 |
| genehacker | is there any law against it? | 04:31 |
| kanzure-_ | I'm sure. | 04:31 |
| genehacker | bah | 04:31 |
| kanzure-_ | I think it would be cheaper to buy the oligos over the internet, but I'm still interested in making a synthesizer | 04:33 |
| genehacker | I like self-sufficiency | 04:34 |
| kanzure-_ | of course. | 04:36 |
| genehacker | hey we could build a biolistic gun to transform plants | 04:36 |
| kanzure-_ | out of what | 04:36 |
| genehacker | the first biolistic guns were modified BB guns | 04:36 |
| genehacker | PVC | 04:36 |
| genehacker | pipe fittigns | 04:36 |
| kanzure-_ | do you mean ballistic? | 04:37 |
| genehacker | biolistic, ballistic, same thing | 04:38 |
| genehacker | just biolistic is more specific | 04:38 |
| genehacker | though gene guns tend to be super-high velocity helium gas guns | 04:40 |
| genehacker | The earliest custom manufactured geneguns (fabricated by Nelson Allen) used a 22 caliber nail gun cartridge to propel an extruded polyethylene cylinder (bullet) down a 22 cal. Douglas barrel. A droplet of the tungsten powder and genetic material was placed on the bullet and shot down the barrel at a lexan "stopping" disk with a petri dish below. The bullet welded to the disk and the genetic... | 04:41 |
| genehacker | ...information blasted into the sample in the dish with a doughnut effect (devastation in the middle, a ring of good transformation and little around the edge). The gun was connected to a vacuum pump and was under vacuum while firing. | 04:41 |
| kanzure-_ | wah, I don't want to have to build a vacuum pump | 04:42 |
| genehacker | then you use helium as a propellent or something like that | 04:42 |
| genehacker | http://www.bio.davidson.edu/Courses/Molbio/MolStudents/spring2003/McDonald/Gene_gun.html | 04:44 |
| kanzure-_ | if we can find a root that drips out recombinant proteins, then that would be ideal | 04:50 |
| kanzure-_ | there are some organisms that grow in simple media and secrete stuff into the liquid medium, but I'm not entirely sure that's the best of ideas | 04:50 |
| kanzure-_ | root dripping would be awesome. | 04:50 |
| genehacker | hmmmm | 04:50 |
| kanzure-_ | berries would be ok maybe. | 04:50 |
| kanzure-_ | ooh | 04:56 |
| kanzure-_ | rhizosecretion | 04:56 |
| fenn | zuh. 11 am | 04:57 |
| fenn | more like 10 | 04:57 |
| kanzure-_ | right | 04:57 |
| kanzure-_ | what is zuh? is it like guh? | 04:57 |
| fenn | sure | 04:57 |
| kanzure-_ | 10:30. | 04:58 |
| kanzure-_ | tomorrow it's produce disassembly stuff. next week is gear optimization (probably the last one on gear stuff since albert is gone) | 04:58 |
| kanzure-_ | *is leaving | 04:58 |
| kanzure-_ | *product | 04:58 |
| fenn | oh this is a 'give a presentation' lab meeting | 04:58 |
| fenn | do you guys ever actually sit down and talk about what you're all doing? | 04:59 |
| kanzure-_ | nope | 04:59 |
| kanzure-_ | heh | 04:59 |
| kanzure-_ | we sit down one-on-one | 04:59 |
| kanzure-_ | but that's not quite the same thing | 04:59 |
| kanzure-_ | we talk about what we're doing in the other lab though .. if that counts. | 05:00 |
| genehacker | woo hoo, they sequenced some of flu | 05:17 |
| genehacker | *swine flu | 05:18 |
| genehacker | MKAILVVMLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK | 05:19 |
| genehacker | LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE | 05:19 |
| genehacker | QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK | 05:19 |
| genehacker | SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ | 05:19 |
| genehacker | EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK | 05:19 |
| genehacker | GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG | 05:19 |
| genehacker | MVDGWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR | 05:19 |
| genehacker | IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG | 05:19 |
| genehacker | CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS | 05:19 |
| genehacker | LVLVVSLGAISFWMCSNGSLQCRICI | 05:19 |
| kanzure-_ | yeah. | 05:20 |
| genehacker | http://www.google.com/search?q=MKAILVVMLYTFATANADTLCIGYHANNSTDTVDTVLEKNVTVTHSVNLLEDKHNGKLCK+LRGVAPLHLGKCNIAGWILGNPECESLSTASSWSYIVETSSSDNGTCYPGDFIDYEELRE+QLSSVSSFERFEIFPKTSSWPNHDSNKGVTAACPHAGAKSFYKNLIWLVKKGNSYPKLSK+SYINDKGKEVLVLWGIHHPSTSADQQSLYQNADAYVFVGSSRYSKKFKPEIAIRPKVRDQ+EGRMNYYWTLVEPGDKITFEATGNLVVPRYAFAMERNAGSGIIISDTPVHDCNTTCQTPK+GAINTSLPFQNIHPITIGKCPKYVKSTKLRLATGLRNVPSIQSRGLFGAIAGFIEGGWTG+MVD | 05:20 |
| genehacker | GWYGYHHQNEQGSGYAADLKSTQNAIDEITNKVNSVIEKMNTQFTAVGKEFNHLEKR+IENLNKKVDDGFLDIWTYNAELLVLLENERTLDYHDSNVKNLYEKVRSQLKNNAKEIGNG+CFEFYHKCDNTCMESVKNGTYDYPKYSEEAKLNREEIDGVKLESTRIYQILAIYSTVASS+LVLVVSLGAISFWMCSNGSLQCRICI&ie=utf-8&oe=utf-8&aq=t&rls=org.mozilla:en-US:official&client=firefox-a | 05:20 |
| genehacker | hmmmm.... | 05:20 |
| genehacker | preliminary data? | 05:20 |
| genehacker | http://www.iayork.com/Temp/SwineFluOnlyAlign.txt | 05:21 |
| genehacker | damn where's the sequence | 05:21 |
| genehacker | http://stephan-zielinski.com/dwa/2009/04/28/swine-flu-ha-as-ambient-music/ | 05:21 |
| genehacker | all I can find is this | 05:21 |
| kanzure-_ | I posted a link to diybio | 05:22 |
| kanzure-_ | or someone else did | 05:23 |
| genehacker | hmmmm.... | 05:23 |
| genehacker | now how do I do sequence comparison again | 05:23 |
| kanzure-_ | what do you want to do? homology analysis? | 05:23 |
| genehacker | compare with other stuff | 05:24 |
| genehacker | multiple sequence alignment | 05:24 |
| genehacker | that sorta stuff | 05:24 |
| kanzure-_ | you need to say something in particular. | 05:24 |
| kanzure-_ | alignment? | 05:24 |
| genehacker | yeah | 05:25 |
| kanzure-_ | or do you want to just look for homologues or something? | 05:25 |
| kanzure-_ | alignment is something you do before you submit the sequence | 05:25 |
| genehacker | as in compare it to other flu viruses | 05:25 |
| kanzure-_ | what do you want to get as a result of the comparison | 05:25 |
| fenn | blast search | 05:26 |
| fenn | or try to use clustal if you're comparing specific things | 05:26 |
| genehacker | http://www.ncbi.nlm.nih.gov/nuccore/FJ966970 | 05:26 |
| genehacker | Oseltamivir_resistance sensitive? | 05:26 |
| genehacker | what does that mean? | 05:26 |
| genehacker | oh we're good | 05:27 |
| fenn | adamantane resistant! | 05:27 |
| fenn | we can use this to wipe out those russian supersoldiers | 05:27 |
| kanzure-_ | the gorillas? | 05:27 |
| genehacker | hahahah | 05:28 |
| fenn | omega red, etc | 05:28 |
| genehacker | chemical it's based on is essentially a subunit of diamond | 05:28 |
| kanzure-_ | what are these plastic sleeve bioreactor thingies? | 05:29 |
| fenn | how does duckweed growth compare to algae? | 05:31 |
| genehacker | plastic sleeve bioreactors? | 05:31 |
| genehacker | you mean like with big bags of plastic | 05:32 |
| fenn | wp says 10 to 30 tons per hectare year | 05:32 |
| kanzure-_ | er, people are using these mist reactors for roots in a different way. I was hoping they were hanging roots and the roots would drip my recombinant proteins. | 05:32 |
| katsmeow-afk | 10 tons dry? | 05:34 |
| kanzure-_ | ah, "root exudation" | 05:34 |
| fenn | most proteins dont drip | 05:34 |
| kanzure-_ | what about in a sap | 05:35 |
| genehacker | maple trees? | 05:48 |
| kanzure | no, I don't want to have to grow trees | 06:26 |
| fenn | i dont quite understand your message to diybio re: inventory lists | 06:52 |
| fenn | did someone make a bio lab inventory? | 06:52 |
| ybit | kanzure, where did the cell membrane diagram svg come from? | 08:07 |
| faceface | I think you guys may have discussed this before, but what about a 'nano printing press' for DNA sysnthesis? | 08:23 |
| faceface | with DNA bases (or mimetic molecules) covalently linked to moveable supports, like little arms, that could be 'typeset' for opposite strand DNA synthesis | 08:24 |
| faceface | somehow the device could interface with DNAPol, allowing it to do the synthesis step. After each reaction the arm could be retracted and the arm complementart to the next base could be inserted | 08:25 |
| faceface | wash repeat | 08:26 |
| faceface | of course it would be really cool if you didn't have to wash... any one got references for nano-mechanically controlled enzyme kinetics? | 08:26 |
| faceface | i.e. fix the enzyme, let it run, jam a rod in the active site, retract rod, repeat | 08:27 |
| faceface | no grim simily intended | 08:27 |
| faceface | i.e. can you deactivate an imobilized enzyme mechanically? second, can you alter enzyme specificity mechanically? i.e. DNApol for synth. | 08:28 |
| faceface | I remember a lot about programmable DNA pol in the chan. | 08:28 |
| faceface | p.s. can someone improve this for me? http://en.wikipedia.org/wiki/DNA_microarray#Fabrication | 08:29 |
| fenn | i see what you mean.. like a line printer | 08:29 |
| fenn | the problem is how do you get the information into the enzyme | 08:29 |
| faceface | fenn: yeah, like a little printing press | 08:29 |
| fenn | my idea was to use three 'antennae' to pick up monochromatic light signals | 08:29 |
| fenn | also, instead of a line printer it'd print one base at a time | 08:30 |
| faceface | fenn: the idea was to induce a mechanical change in the enzyme? | 08:30 |
| fenn | yes | 08:30 |
| fenn | a 'conformational change' as the biologists like to have it | 08:31 |
| faceface | fenn: that makes more sense, but I was also thinking of 'typesetting' a chunk of DNA at a time | 08:31 |
| faceface | fenn: right | 08:31 |
| fenn | but chunking doesn't gain anything at all | 08:31 |
| faceface | I see what your saying | 08:31 |
| fenn | you want to make a fake template strand | 08:32 |
| fenn | i'm talking about hijacking the polymerase | 08:32 |
| faceface | fenn: I also think that modified DNApol could be used for sequencing, i.e. if it went through specific conformational change depending on the base it was at | 08:32 |
| fenn | anyway, i dont see how you're going to be able to build a fake template in the first place | 08:32 |
| faceface | fenn: yeah, roughly two different ideas, both using immobilized base mimetics on a physically moveable support | 08:32 |
| fenn | gosh when did everything get so difficult | 08:33 |
| faceface | fenn: right, constructing the template sequence is as hard as synthesizing the DNA (potentially)1 | 08:33 |
| faceface | whats that? | 08:33 |
| * fenn just spent 3 hours designing a blinky light for a bike.. and he's nowhere close to done | 08:34 | |
| faceface | ;-) | 08:34 |
| faceface | keep at it! | 08:34 |
| fenn | now, normally i'd just use a microcontroller | 08:34 |
| fenn | but stupid me decided to do it on stripboard | 08:34 |
| fenn | because i have been playing with this stripboard cad program | 08:34 |
| faceface | cool | 08:35 |
| fenn | and now i'm all confused whether i'm looking at it mirrored or not | 08:35 |
| fenn | because i cant figure out how to label the 555 footprint | 08:35 |
| fenn | oh, duh, nevermind | 08:36 |
| fenn | now i see you're supposed to edit the footprint | 08:36 |
| fenn | not like i expect anyone to notice any errors or anything http://imagebin.org/47239 | 10:50 |
| fenn | if you can even figure out wtf is going on.. it's based on this http://ourworld.compuserve.com/homepages/Bill_Bowden/555exp.gif | 10:51 |
| genehacker | http://www.mrdv.org/experiences.html | 12:09 |
| genehacker | interesting | 12:09 |
| genehacker | http://www.foresight.org/nanodot/?p=3020 | 12:13 |
| genehacker | reprap is nanotech? | 12:14 |
| kanzure | faceface: there have been some papers on PDMS for DNA synthesis, btw. nanoimprint lithography, etc. | 13:58 |
| faceface | PDMS? | 13:58 |
| kanzure | fenn: we had partial inventory lists. | 14:00 |
| kanzure | fenn: I don't understand your imagebin diagram thingy. is that supposed to be a circuit? what's with the fat line widths? | 14:00 |
| kanzure | faceface: yes. | 14:00 |
| kanzure | see this | 14:01 |
| kanzure | http://heybryan.org/books/papers/Oligonucleotide%20on-chip%20synthesis%20using%20PDMS%20stamp.pdf | 14:01 |
| faceface | kanzure: no, I meant, what are PDMS? | 14:05 |
| faceface | Swine flu virus kills child in US | 14:06 |
| kanzure | it's a polymer that cures when exposed to light | 14:06 |
| faceface | I knew this woudl start happening as soon as they said 'we should expect this to happen' | 14:06 |
| faceface | seems all news hapens that way now... | 14:06 |
| faceface | we should expect to see... bang .. it happens... I guess I should expect it | 14:06 |
| faceface | kanzure: right | 14:07 |
| * kanzure goes down to eat | 14:16 | |
| kanzure | http://jscms.jrn.columbia.edu/cns/2009-04-14/vaidyanathan-citizenscience | 14:47 |
| myelinzar | this is so stupid | 15:23 |
| myelinzar | http://openwetware.org/wiki/Talk:DIYbio:Equipment | 15:23 |
| myelinzar | why is he doing this. | 15:23 |
| * myelinzar throws a rock at Bill | 15:23 | |
| myelinzar | http://heybryan.org/books/papers/design-utility-search.png | 16:47 |
| myelinzar | http://heybryan.org/diagrams/symbolic-regression-design.png | 17:46 |
| myelinzar | behold! my mad diagramming skillage | 17:46 |
| kanzure | http://www.youtube.com/watch?v=Ascql_RoeBU has a nice video composition of feet | 18:29 |
| kanzure | bipedal octopus disguised as a rolling coconut | 18:30 |
| kanzure | Towards a spiderman suit | 18:59 |
| kanzure | http://heybryan.org/books/papers/Towards%20a%20Spiderman%20suit%20-%20large%20invisible%20cables%20and%20self-cleaning%20releasable%20superadhesive%20materials.pdf | 18:59 |
| kanzure | hm, I think I can bike from my apartment to my dorm | 22:31 |
| kanzure | er, to the university | 22:31 |
| kanzure | about six miles, so 12 mi a day. that sounds doable. | 22:31 |
| kanzure- | duzt: Were you able to find the parts you needed? | 22:49 |
| kanzure- | "We are very encouraged by these results, which show that oral delivery of a | 23:11 |
| kanzure- | therapeutic dose of small, interfering RNA (siRNA) to a specific cell type in an | 23:11 |
| kanzure- | animal model is possible, and that evidence of gene silencing using this | 23:11 |
| kanzure- | delivery system is measurable," said Dr. Czech. | 23:11 |
| duzt | kanzure ya | 23:21 |
| duzt | i also got a book that has all sorts of cheap designs for bio equipment | 23:21 |
| duzt | low costs methods for pcr or something like that | 23:22 |
| kanzure- | is that the name of the book? | 23:26 |
| kanzure- | hm. guttation. | 23:49 |
| duzt | kanzure: http://www.google.com/url?sa=t&source=web&ct=res&cd=1&url=http%3A%2F%2Fwww.amazon.com%2FLow-Cost-Approach-PCR-Appropriate-Biomolecular%2Fdp%2F0195119266&ei=uOf4SdrtHNjHtgeeydy1Dw&usg=AFQjCNFcXLh4FHsgJVoByF766ugtayeO7Q | 23:50 |
| duzt | err | 23:50 |
| kanzure- | phyllosecretion | 23:54 |
| kanzure- | oh, that's from leaves. | 23:55 |
Generated by irclog2html.py 2.15.0.dev0 by Marius Gedminas - find it at mg.pov.lt!
